DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG34171

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:286 Identity:64/286 - (22%)
Similarity:109/286 - (38%) Gaps:76/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTI 67
            |.:|..|:||.|.        |::.||           ||                 :..|.|.|
  Fly    33 SHLSSYLVSLRTR--------KYIHTP-----------GD-----------------NHFCTGVI 61

  Fly    68 IHMRFVLSAAHC-------LVRGYDLYVRLGARNINEPAAVHTVINV--FVHHDFIASEYRNDIG 123
            :..|.||::|||       ::....:.|.|.|.....|.:...|:::  .:.|.:......|||.
  Fly    62 LTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQHNDIA 126

  Fly   124 LLQLSESIVYTVRVQPICIFLDPALKG--SVEKLKTFRALG--WGNRNGKL----SIMLQTIYLL 180
            :::|...:.....      .|.|.:.|  |:|.....:.:|  :|.|..:.    |::|..:.|.
  Fly   127 IIKLKRYVKLDGH------HLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELR 185

  Fly   181 HLKRNECKRKLNFNL------NSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSF 239
            ..  :|| .|:..:|      |...||..:.....|..|.|||     ||...:.|.:.||.::.
  Fly   186 PF--DEC-LKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGP-----LFCDGQLYGIALGSINC 242

  Fly   240 GDPECRGVGVYTDVTSYVDWISSTIA 265
            ..|:   ...::||:.|..|::..|:
  Fly   243 SSPD---PVFFSDVSFYNSWVTKIIS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 53/245 (22%)
Tryp_SPc 38..263 CDD:238113 54/247 (22%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 62/279 (22%)
Tryp_SPc 38..263 CDD:304450 61/277 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.