DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG9737

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:279 Identity:89/279 - (31%)
Similarity:128/279 - (45%) Gaps:54/279 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGISTRPKISGGDDAAEPNSIWMA-AIFNSSDFQCGGTIIHMRFVLSAAHCLVRGYDL------- 86
            ||.....:|.||:.|......|:| .::||:|:.|.|.:|..|.:|:|||| |:|..:       
  Fly   142 CGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHC-VQGEGVRDRQGLK 205

  Fly    87 YVRLGARN-------INEP-------AAVHTVI-NVFVHHDFIA-SEYR-NDIGLLQLSESIVYT 134
            :||||..|       |.||       ||:.... .:.||.::.. |.|: |||.:::|...:.:|
  Fly   206 HVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT 270

  Fly   135 VRVQPICIFLDPALKGSVEKL-----KTFRALGWG----------NRNGKLSIMLQTIYLLHLKR 184
            ..|.|||      |....|.|     :.|...|||          |.:..:.:.|:..|:.:...
  Fly   271 HFVMPIC------LPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENC 329

  Fly   185 NECKRKLNFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVG 248
            .:........|..:|||||.:.. |||.|||||||   :.|....|..|..|:||:|..:|...|
  Fly   330 TKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPL---MYFDRQHSRWVAYGVVSYGFTQCGMAG 391

  Fly   249 ---VYTDVTSYVDWISSTI 264
               |||:|..|.|||.|.:
  Fly   392 KPAVYTNVAEYTDWIDSVV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 84/266 (32%)
Tryp_SPc 38..263 CDD:238113 86/268 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 84/266 (32%)
Tryp_SPc 150..409 CDD:238113 86/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.