DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:115/250 - (46%) Gaps:34/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TPCGI-STRPKISGGDDAAEPNSIWMAAIF--NSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYVR 89
            ||..| ..:.:|:.|..|.|....::..:.  .:.::.|||:||...:||:||||......:.:.
  Fly    25 TPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTIN 89

  Fly    90 LGARNINEPAAVHTV--INVFVHHDFIASEYRNDIGLLQLSE----SIVYTVRVQPICIFLDPAL 148
            .||....:|...|.|  .::..||.:.:....|||.|::...    |:|..|.:        |:.
  Fly    90 YGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPHVDFWSLVNKVEL--------PSY 146

  Fly   149 KGSVEKLKTFRAL--GWGNR--NGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKNG-D 208
            ....:....:.|:  |||..  ...|...||::.:..:.:::|.|  .::|:...||..|..| .
  Fly   147 NDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSR--TWSLHDNMICINTDGGKS 209

  Fly   209 TCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPE-CR--GVGVYTDVTSYVDWI 260
            ||.|||||||.|:   ..|:    .:|:.|||... |:  ...|::.||.|:|||
  Fly   210 TCGGDSGGPLVTH---DGNR----LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 65/238 (27%)
Tryp_SPc 38..263 CDD:238113 66/238 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 66/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.