DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG11843

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:293 Identity:95/293 - (32%)
Similarity:139/293 - (47%) Gaps:64/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ENEHFKFLETPCGISTR---------PKISGGDDAAEPNSIWMAAI------FNSSDFQCGGTII 68
            |...|.||.....|.:|         |.|.||..|.......||.:      .:.:|:.|||.:|
  Fly    40 ERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLI 104

  Fly    69 HMRFVLSAAHCL--VRGYDLYVRLGA---RNINEPAAV--HTVINVFVHHDFIASEYRNDIGLLQ 126
            ..||||:|||||  .||....||||.   .:::|.||.  :.|.....|..:...::.:||||::
  Fly   105 SERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVK 169

  Fly   127 LSESIVYTVRVQPICI-FLDPALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLKRNE---- 186
            |:|::|:.:...|.|: |.|.....|      |.|:|||:....|....|   ||.:|...    
  Fly   170 LTEAVVFDLYKHPACLPFQDERSSDS------FIAVGWGSTGLALKPSAQ---LLKVKLQRYGNW 225

  Fly   187 -CKRKL---------NFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYE---VQLGI- 236
             ||:.|         .|:.|: |:|.|::.. |||.|||||||   :::  ::.|.   |.:|| 
  Fly   226 VCKKLLTRQVEEFPRGFDGNN-QLCVGSEMAQDTCNGDSGGPL---LMY--HREYPCMYVVVGIT 284

  Fly   237 ---VSFGDPECRGV-GVYTDVTSYVDWISSTIA 265
               :|.|.|   |: |:||.|..|:.||:.|:|
  Fly   285 SAGLSCGSP---GIPGIYTRVYPYLGWIARTLA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 84/259 (32%)
Tryp_SPc 38..263 CDD:238113 86/261 (33%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 86/261 (33%)
Tryp_SPc 68..309 CDD:214473 84/258 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.