DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG11841

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:281 Identity:84/281 - (29%)
Similarity:121/281 - (43%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKFLETPCGIST-------RPKISGGDDAAEPNSIWMAAIF------NSSDFQCGGTIIHMRFVL 74
            |.|.:.|....|       ||.|..| ..|||.....||..      |...:.||||:|..|.||
  Fly    50 FFFTDAPITYETVDSCHGSRPLIVDG-TPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVL 113

  Fly    75 SAAHCLV--RGYDLYVRLGARNIN------EPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESI 131
            :||||..  .|....||||....:      ||.. ..|:.:..|..|...:..||||::||...:
  Fly   114 TAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPED-FGVLALKAHPGFENPQLYNDIGIVQLDREV 177

  Fly   132 VYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN--GKLSIMLQTIYLLHLKRNECKRKLNFN 194
            .:.....|.|:..|..     |:.::|.|:|||.:.  .|.|..|..:.|...| :.|...::.|
  Fly   178 KFNRYKHPACLPFDDG-----EQHESFIAIGWGQKKFAQKESKKLLKVQLQGYK-DRCVSSVDAN 236

  Fly   195 LN-------SRQICAGTK-NGDTCRGDSGGPLSTNILFPSNKS--YEVQLGIVSFG----DPECR 245
            ..       ..|:|.|:: |.|||.||||||:   :.:..:.:  |.| :||.|.|    .|:. 
  Fly   237 DELPNGYEPKSQLCIGSRDNKDTCNGDSGGPV---LAYHKDLACMYHV-MGITSAGITCSTPDI- 296

  Fly   246 GVGVYTDVTSYVDWISSTIAR 266
             ...||.|..:::||...:|:
  Fly   297 -PSAYTRVHYFLNWIKGELAK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 75/252 (30%)
Tryp_SPc 38..263 CDD:238113 77/254 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 76/252 (30%)
Tryp_SPc 72..310 CDD:214473 75/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.