DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG5909

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:263 Identity:73/263 - (27%)
Similarity:128/263 - (48%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TPCGISTRPKISGGDDAAEPNSIWMAAI-FNSSD---FQCGGTIIHMRFVLSAAHCLVRGYD-LY 87
            |.||....||:|||..|...:..|:|.: :..:|   |:|||::|..|.:|:||||::...: :.
  Fly   120 TNCGNKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVIA 184

  Fly    88 VRLGARNINE----------------PAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVR 136
            ||||..::..                |...:.:..:.||.:::..:..:|:.:::|...:.....
  Fly   185 VRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSH 249

  Fly   137 VQPICIFLDPALKGSVEKLKTFRALGWGNRNGK-LSIMLQTIYLLHLKRNECKRKLN-FNLNSRQ 199
            ::|:|:.:|...: .::..::|...|||....: ::..||...:.....|||::..| ..::...
  Fly   250 IKPVCLPIDQKSQ-ELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEVSDNH 313

  Fly   200 ICA-GTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPEC--RGVGVYTDVTSYVDWIS 261
            ||| ||....||:||||||:.....| .|....||.|:||||...|  ...||:..|...:.||:
  Fly   314 ICATGTGIKHTCQGDSGGPVFFKHRF-KNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPWIT 377

  Fly   262 STI 264
            ..:
  Fly   378 QNL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 67/248 (27%)
Tryp_SPc 38..263 CDD:238113 68/250 (27%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 67/248 (27%)
Tryp_SPc 132..379 CDD:238113 67/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.