DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and grass

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:278 Identity:92/278 - (33%)
Similarity:135/278 - (48%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FKFLETPCGISTRPKISGGDDAAEPNSIWMAAI----FNSSDFQCGGTIIHMRFVLSAAHCLVRG 83
            ||.....||.....::|.|.:....:..|||.:    |..|.|.|||.:|..|::|:|||| |.|
  Fly   104 FKDENFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHC-VHG 167

  Fly    84 Y--DLY-VRLGARNIN----------EPAAVHTVINV-----FVHHDFIASEYRNDIGLLQLSES 130
            .  ||| :|||...|:          :......|:||     .:|..:.|....:||.||:|:.|
  Fly   168 LQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRS 232

  Fly   131 IVYTVRVQPICIFLDPALKGSVEKLKTFRALGWG-NRNGKLS-IMLQTIYLLHLKRNECKRKLNF 193
            :.:...::|||:.:...||...|::.|:...||| ..||..| ::||....|. .|:.|.:....
  Fly   233 VPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQ-PRSACSQAYRR 296

  Fly   194 NLNSRQICAGTKN-GDTCRGDSGGPLSTNILFPSNKSYE-----VQLGIVSFGDPECRGV---GV 249
            .:...|:|.|..: .|:|:|||||||..    |:....|     |:.||||.|...|..:   |:
  Fly   297 AVPLSQLCVGGGDLQDSCKGDSGGPLQA----PAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGL 357

  Fly   250 YTDVTSYVDWISSTIARN 267
            ||:|..||.||:.|:|.|
  Fly   358 YTNVGEYVQWITDTMASN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 83/255 (33%)
Tryp_SPc 38..263 CDD:238113 85/257 (33%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 84/255 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.