DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and SPE

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:288 Identity:82/288 - (28%)
Similarity:122/288 - (42%) Gaps:69/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGISTRPKISGGDDAAEPNSIWMA-----AIFNSS-DFQCGGTIIHMRFVLSAAHCLV------R 82
            ||.....:|.||.:.......||.     .:|:.: .|.|||.:::.|:||:|.|||.      .
  Fly   127 CGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKS 191

  Fly    83 GYDLY-VRLG---------------ARNINEPAAVHTVINVFVHHDFIAS---EYRNDIGLLQLS 128
            |..|: ||||               .:.|..|..:...:...:.|:..|.   :.||||.|::|.
  Fly   192 GAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLK 256

  Fly   129 ESIVYTVRVQPICI---------FLDPALKGSVEKLKTFRALGWGNRNG------KLSIMLQTIY 178
            ..:.||..|:|||:         |:|..:.          ..|||....      ||.|   |:.
  Fly   257 RIVSYTDYVRPICLPTDGLVQNNFVDYGMD----------VAGWGLTENMQPSAIKLKI---TVN 308

  Fly   179 LLHLKRNECKRK---LNFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSF 239
            :.:|  ..|:.|   ....|:..|:|||.:.| |||.|||||||...|.......:.: .|:.|:
  Fly   309 VWNL--TSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYI-AGVTSY 370

  Fly   240 GDPEC--RG-VGVYTDVTSYVDWISSTI 264
            |...|  :| .||||...:::|||...:
  Fly   371 GTKPCGLKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 78/275 (28%)
Tryp_SPc 38..263 CDD:238113 80/277 (29%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 80/277 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463518
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.