DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG31199

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:235 Identity:51/235 - (21%)
Similarity:77/235 - (32%) Gaps:57/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLSLLTLCVTENEHFKFLETPCGISTRPKISGGDD--AAEPNSIWMAAIFNSSDFQ-------CG 64
            ||.|:.|...|....|..:..||.....::.....  |......|:|.|.....|:       |.
  Fly     8 LLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRDNGCL 72

  Fly    65 GTIIHMRFVLSAAHCLVRGYD-----LYVRLGARNINEPAAVHT---------------VINVFV 109
            |.::..|.||:.|||.|: |:     ..|.||..|.:.|..|..               :..:.:
  Fly    73 GVLVSKRTVLAPAHCFVQ-YNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIAI 136

  Fly   110 HHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALG-----------W 163
            |.|:.:...:|.:.:|.|.........|.|||: ..|:|.......:||...|           |
  Fly   137 HPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICM-PPPSLLNETLVAQTFVVAGLRVFEDFRLKTW 200

  Fly   164 GNRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAG 203
            .|.               |.|..|:.|:...:.|.....|
  Fly   201 VNT---------------LSRGFCQSKVKTLVTSSNTVCG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 43/207 (21%)
Tryp_SPc 38..263 CDD:238113 43/206 (21%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 43/198 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.