DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG31219

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:276 Identity:89/276 - (32%)
Similarity:131/276 - (47%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CG--ISTRPKISGGDDAAEPNSI-WMAAI--FNSSDFQ----CGGTIIHMRFVLSAAHCLVRGY- 84
            ||  :||...:.|.:  |.||.. |||.:  .|::..:    |.|::|:.|:||::||| |.|. 
  Fly    80 CGQSLSTYRMVGGSE--ARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHC-VNGIP 141

  Fly    85 -DL---YVRLGARNI--------------NEPAAVHTVI---NVFVHHDFIASEYRN---DIGLL 125
             ||   .||||..:|              |:.|..:..|   .:.||..|.:...||   ||.||
  Fly   142 RDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALL 206

  Fly   126 QLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN-GKLSIMLQTIYLLHLKRNECKR 189
            :|...:.|...:.||||    ...|...|.| ....|||..| |:.|.:|...::.......|..
  Fly   207 RLKMPVRYRTGIMPICI----PKHGFFAKSK-LEIAGWGKTNEGQFSQVLMHGFIRERSIAVCAL 266

  Fly   190 KLNF-NLN-SRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGV---G 248
            :..: :|| |.|||||..:| |||:|||||||...:   .|.|..: .||.::|...|..:   |
  Fly   267 RFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTM---DNSSVYL-AGITTYGSKNCGQIGIPG 327

  Fly   249 VYTDVTSYVDWISSTI 264
            :||..::::.||.:.:
  Fly   328 IYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 83/261 (32%)
Tryp_SPc 38..263 CDD:238113 85/263 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 83/262 (32%)
Tryp_SPc 90..342 CDD:238113 85/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.