DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG5255

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:281 Identity:80/281 - (28%)
Similarity:135/281 - (48%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLSLLTLCV-TENEHFKFLETPCGISTRPKISGGDDAA---EPNSIWMAAIFNSSDFQCGGTIIH 69
            ||.||.|.: |.:...:.|..|  ..|:.:|.||::||   .|..|.:..| .|....|||.||.
  Fly     2 LLILLPLVLFTSSAASQILYPP--QYTKNRIVGGEEAAAGLAPYQISLQGI-GSGAHSCGGAIID 63

  Fly    70 MRFVLSAAHCLVRGYD---LYVRLGARNINEPAAVHTVINVFVHH-DFIASEYRNDIGLLQLSES 130
            .|::::|||| .||..   ..|..|.:::::..:.:...:..|.| ::...:|||||.||.|:||
  Fly    64 ERWIITAAHC-TRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNES 127

  Fly   131 IVYTVRVQPICIFLDPALKGSVEKLKTFRAL--GWG--NRNGKLSIMLQTIYLLHLKRNECKRKL 191
            ||:....||:.:..:..:.||       |.|  |||  :..|.:...||::.:.::...:|:...
  Fly   128 IVFDNATQPVELDHEALVPGS-------RLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAH 185

  Fly   192 NFNLNSRQICAG------TKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGV-GV 249
            :   ||.::..|      .|....|.|||||||..|         ...:.:|::|.|..:|. ..
  Fly   186 D---NSTRVDIGHVCTFNDKGRGACHGDSGGPLVHN---------GKLVALVNWGLPCAKGYPDA 238

  Fly   250 YTDVTSYVDWISS--TIARND 268
            :..::.|.|:|.:  ::::.|
  Fly   239 HASISYYHDFIRTHLSLSKTD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 69/240 (29%)
Tryp_SPc 38..263 CDD:238113 70/244 (29%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 69/240 (29%)
Tryp_SPc 30..252 CDD:238113 70/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.