DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG5246

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:289 Identity:86/289 - (29%)
Similarity:140/289 - (48%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLVSVALLSLLTLCVTE----------NEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAI 55
            |:.||.:::|.:|:.|..:          |.|...      :....::.||.|:....:.:..:|
  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGH------VKPETRVIGGVDSPTGFAPYQVSI 59

  Fly    56 FNS-SDFQCGGTIIHMRFVLSAAHC---------LVRGYDLYVRLGARNINEPAAVHTVINVFVH 110
            .|: .:..|||:||..:::|:||||         :|.|...|.|.||..:.:.:.:|      ..
  Fly    60 MNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIH------CS 118

  Fly   111 HDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRAL-GWGNRN--GKLSI 172
            ||..|  |.|||.|:..::.|||....|||.:    |.|||:.|:.....| |||:..  |:.|.
  Fly   119 HDKPA--YHNDIALIHTAKPIVYDDLTQPIKL----ASKGSLPKVGDKLTLTGWGSTKTWGRYST 177

  Fly   173 MLQTIYLLHLKRNECKRKL-NFN-LNSRQICAGTKNGD-TCRGDSGGPLSTNILFPSNKSYEVQL 234
            .||.|.|.::..:.|:.:: |.| |:...:|..|:.|: :|.||||||     |..:|::.   :
  Fly   178 QLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGP-----LVDANQTL---V 234

  Fly   235 GIVSFGDPECRGVG---VYTDVTSYVDWI 260
            |:|::|  |...:|   |:..|..|.|||
  Fly   235 GVVNWG--EACAIGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 76/241 (32%)
Tryp_SPc 38..263 CDD:238113 78/242 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 76/241 (32%)
Tryp_SPc 42..263 CDD:238113 78/242 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.