DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG4053

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:292 Identity:80/292 - (27%)
Similarity:130/292 - (44%) Gaps:72/292 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLVSVALLSLLTLCVTENEHF---KFLETPCGISTRPKISGGDDAAEP--------NSIWMAAIF 56
            ||:.:.||. .::.||..:..   |.|:.        :|.||.:|.:.        .:||...| 
  Fly     6 SLIWLLLLG-TSIDVTRGKRLDNRKLLDN--------RIVGGQEAEDGVAPYQVSIQTIWKTHI- 60

  Fly    57 NSSDFQCGGTIIHMRFVLSAAHCLV--RGYDLYVRLGARNINEP--------AAVHTVINV-FVH 110
                  |.|.|::.:::|:|.||.:  ...||.:.:|..:..||        |.||.:.:: :| 
  Fly    61 ------CSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIPYV- 118

  Fly   111 HDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKLSIM-- 173
                   |.|||.|:.::|||::..|.|.:.:..:....||     |....|||........:  
  Fly   119 -------YNNDIALIHVNESIIFNDRTQIVELSREQPPAGS-----TVTLTGWGAPESSYPTVQY 171

  Fly   174 LQTIYLLHLKRNECKRKLNFN--LNSRQICAGTKNGD-TCRGDSGGPLSTNILFPSNKSYEVQL- 234
            |||:.|..:...||:.:.:|:  ::...||..|:.|: .|.|||||||          .:|.:| 
  Fly   172 LQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPL----------MWEGKLV 226

  Fly   235 GIVSFGDPECRGVG---VYTDVTSYVDWISST 263
            |:|::|  ...|||   :|.:...|.|||..|
  Fly   227 GLVNWG--RACGVGMPDMYANTVYYQDWIRRT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 69/250 (28%)
Tryp_SPc 38..263 CDD:238113 71/252 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/250 (28%)
Tryp_SPc 35..256 CDD:238113 71/252 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.