DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG17475

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:277 Identity:79/277 - (28%)
Similarity:134/277 - (48%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQ-----------C 63
            :|.:.|.....:..:::....|::.:.::..|:|..          ...:.:|           |
  Fly    22 ISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQ----------LGEAKYQISLQGMYGGHIC 76

  Fly    64 GGTIIHMRFVLSAAHCLVRGYD-LYVRL--GARNINEPAAVHTVINVFVHHDFIASEYRNDIGLL 125
            ||.||..|.||:|||| |.||: .|:|:  |.....:|.||:.|...::|.::.:.:|.|||.|:
  Fly    77 GGCIIDERHVLTAAHC-VYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALI 140

  Fly   126 QLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN--GKLSIMLQTIYLLHLKRNECK 188
            :|:::|.:....||..:...|...|: :.|.|    |||:..  |....:||..||.|:..:.|:
  Fly   141 RLNDTIKFNEYTQPAELPTAPVANGT-QLLLT----GWGSTELWGDTPDILQKAYLTHVVYSTCQ 200

  Fly   189 RKLNFNLNSR--QICAGTKNGD-TCRGDSGGPLSTN-ILFPSNKSYEVQLGIVSFGDPECRGV-G 248
            ..:|.:.::.  .||..|..|. .|.|||||||:.| :|:          |:|::|.|...|| .
  Fly   201 EIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLY----------GLVNWGYPCALGVPD 255

  Fly   249 VYTDVTSYVDWISSTIA 265
            .:.:|..|::||.|.|:
  Fly   256 SHANVYYYLEWIRSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/243 (30%)
Tryp_SPc 38..263 CDD:238113 74/245 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/243 (30%)
Tryp_SPc 50..269 CDD:238113 74/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.