DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG17477

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:280 Identity:85/280 - (30%)
Similarity:132/280 - (47%) Gaps:44/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RSLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAE---PNSIWMAAIFNSSDFQC 63
            |.|..:.:.|.|...:...|||              |.||.:|||   |..:.:..:..|  ..|
  Fly     5 RFLFYILVFSSLYCDLLALEHF--------------IVGGQNAAEGDAPYQVSLQTLLGS--HLC 53

  Fly    64 GGTIIHMRFVLSAAHCLVRGYD---LYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLL 125
            ||.||..|::::|.|| |:||.   |.|..|.....||.||:....:::|.::.:.:|:||||||
  Fly    54 GGAIISDRWIITAGHC-VKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLL 117

  Fly   126 QLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN--GKLSIMLQTIYLLHLKRNECK 188
            .|:|||.:....|.:.:...|..:|:.|.:.|    |||:::  |.|...||.:...||....|:
  Fly   118 HLNESITFNALTQAVELPTSPFPRGASELVFT----GWGSQSAAGSLPSQLQRVQQQHLNSPACE 178

  Fly   189 RKL----NFNLNSRQICAGTK-NGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGV- 247
            ..:    :..|....|||..: |...|.|||||||         ......:||::|..|..:|| 
  Fly   179 SMMSAYEDLELGPCHICAYRQANIGACHGDSGGPL---------VHQGTLVGILNFFVPCAQGVP 234

  Fly   248 GVYTDVTSYVDWISSTIARN 267
            .::.::..|.||:..|::.|
  Fly   235 DIFMNIMYYRDWMRQTMSGN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 75/236 (32%)
Tryp_SPc 38..263 CDD:238113 76/238 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 76/238 (32%)
Tryp_SPc 27..246 CDD:214473 74/234 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.