DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and modSP

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:273 Identity:71/273 - (26%)
Similarity:113/273 - (41%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ETPCG-ISTRPK--ISGG---DDAAEPNSIWMAAIFNSSD--FQCGGTIIHMRFVLSAAHC---- 79
            |..|| ::|..|  .|||   ::...|..:.:....|..|  |||||:::....|::||||    
  Fly   355 EQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDE 419

  Fly    80 ---LVRGYDLYVRLGA---RNINEPAAVH-----TVINVFVHHDFIASEYRNDIGLLQLSESIVY 133
               |...||.:..:.|   ||..|.....     .:|.:...:......|..|:.||.|.|....
  Fly   420 GTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFEL 484

  Fly   134 TVRVQPICI-FLDPALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNS 197
            :..::|||: |...|.|.||......:..||...|   ...||.:..:....:.|:|.|. ::.:
  Fly   485 SHVIRPICVTFASFAEKESVTDDVQGKFAGWNIEN---KHELQFVPAVSKSNSVCRRNLR-DIQA 545

  Fly   198 RQICAGTKNGD-TCRGDSGG----PLSTNILFPSNKSYEVQLGIVS---FGDPECRGVGVYTDVT 254
            .:.|..|:... .|:|||||    .|.||.....|.:.....|::|   ..|.....:.|.|::.
  Fly   546 DKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLTVMTNIQ 610

  Fly   255 SYVDWISSTIARN 267
            .:.|.|.:.:.|:
  Fly   611 HFEDMILNAMNRS 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 65/253 (26%)
Tryp_SPc 38..263 CDD:238113 65/253 (26%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 63/248 (25%)
Tryp_SPc 371..591 CDD:304450 58/223 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.