DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG3505

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:298 Identity:82/298 - (27%)
Similarity:117/298 - (39%) Gaps:62/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQ-----CGG 65
            |.|.|..||        ...|.:.|| ..|.:.|...|.......|:|.|..:...|     |||
  Fly    84 STAGLGALT--------HPLLPSDCG-KVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGG 139

  Fly    66 TIIHMRFVLSAAHCLVRGYDLYVRLGARNINE---------------------PAAVHTVINVFV 109
            .:|..|:||:||||:.:.....:::.|..:.|                     |......|...:
  Fly   140 VLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELL 204

  Fly   110 HHDFIASEYR---NDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGW----GNRN 167
            .|.......|   |||.|::|:........|||||:.........:|.|.| ...||    ..|.
  Fly   205 PHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVT-EVAGWQASSSQRM 268

  Fly   168 GKLSIMLQTIYLLHLKRNECKRKL---NFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKS 229
            .|..:.:.:|       .||:||.   ...:.:.::| |..|...|.|::||||   :|| .|..
  Fly   269 RKGYVTISSI-------EECQRKYASQQLRIQASKLC-GLTNSQECYGNAGGPL---MLF-KNDG 321

  Fly   230 YEVQLGIVSFGDPECRG---VGVYTDVTSYVDWISSTI 264
            |.:. |:||||...|..   ..|||.|.||:|||..::
  Fly   322 YLLG-GLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 71/261 (27%)
Tryp_SPc 38..263 CDD:238113 73/263 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 72/258 (28%)
Tryp_SPc 111..354 CDD:214473 70/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.