DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG31326

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:263 Identity:74/263 - (28%)
Similarity:112/263 - (42%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PCG---ISTRPKISGGDDAAEPNSIWMAAIF-----NSSDFQCGGTIIHMRFVLSAAHCL-VRGY 84
            |||   .||.|.|..|.........|:.|||     |...|.||||:|....|||||||. ..|.
  Fly   262 PCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGR 326

  Fly    85 D-----LYVRLGARNINEPAAVHT------VINVFVHHDFIASEYRN-DIGLLQLSESIVYTVRV 137
            |     |.|.||...:    |:|:      |..:.:|.:|...::.. |:.|::|.|.:.||..:
  Fly   327 DLPASRLAVSLGRNTL----AIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYI 387

  Fly   138 QPICIFLDPALKGSVEKLKTFRALGWG-NRNGKLSIMLQTIYLLHL-KRNECKRKL-NFNLNSRQ 199
            .|||::.........:.||::.| ||| :..|..:..:..:..|:: ....|..:| :..:....
  Fly   388 VPICLWSTSNRMDLPQGLKSYVA-GWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSS 451

  Fly   200 ICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFG-------DPECRGVGVYTDVTSYV 257
            :||.......|..|.||||...     .:...|..|::|.|       ..|.....|:|||..::
  Fly   452 LCAKKTGAGPCASDGGGPLMLR-----EQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHI 511

  Fly   258 DWI 260
            :|:
  Fly   512 EWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 67/250 (27%)
Tryp_SPc 38..263 CDD:238113 68/251 (27%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 67/248 (27%)
Tryp_SPc 277..514 CDD:214473 66/246 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.