DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG9649

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:266 Identity:76/266 - (28%)
Similarity:116/266 - (43%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CG---ISTRPKISGGDDAAEPNSIWMAAIF----NSSDFQCGGTIIHMRFVLSAAHCL------V 81
            ||   :...|.|..|.:.......||||:|    ...:|.||||:|..|.|:|||||.      :
  Fly   246 CGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNL 310

  Fly    82 RGYDLYVRLGARNIN--EPAAVHTVINVFVHHDFIASEYRN-DIGLLQLSESIVYTVRVQPICIF 143
            .|....|.||..:::  ...|...|..:.:|..:..:.|.: |:.|||||..:.....::|||::
  Fly   311 PGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLW 375

  Fly   144 LDPALKGSVEKLKTFRALGW-----GNRNGKLSIMLQTIYLLHLKRNECKRKLNFN----LNSRQ 199
            .:..|.......|::.| ||     ||||.:|:.|..|..:...   ||:..|:..    :.|..
  Fly   376 NENFLLELPSGHKSYVA-GWGEDEKGNRNTRLAKMTDTDIITQW---ECRGNLSEENAKFITSHT 436

  Fly   200 ICAGTKNGD-TCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVG-----VYTDVTSYVD 258
            |||...... .|.|||||.|..     ..:...:..|:||.|........     :||||..:::
  Fly   437 ICASNAQASGPCSGDSGGGLML-----QEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIE 496

  Fly   259 WISSTI 264
            |:.|::
  Fly   497 WLLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 71/250 (28%)
Tryp_SPc 38..263 CDD:238113 72/252 (29%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 71/249 (29%)
Tryp_SPc 259..497 CDD:214473 70/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.