DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG13318

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:270 Identity:78/270 - (28%)
Similarity:123/270 - (45%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGISTRPKISGGDDAAEPNSI------WMAAIFNSSD-FQCGGTIIHMRFVLSAAHCLVRGYDL- 86
            ||....|  ..|...|.|...      |.||:..::| :..||.:|..:.||:|||   :.|:| 
  Fly   151 CGRRFPP--PPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALITAQHVLTAAH---KVYNLG 210

  Fly    87 ----YVRLG---ARNINEPAAVHTVI--NVFVHHDFIASEYRNDIGLLQLSESIVYTVR--VQPI 140
                .||||   |.:.:||.....|.  ||:|:..|..:..:||:.:|:||..:..|.:  |..:
  Fly   211 LTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTV 275

  Fly   141 CIFLDPALKGSVEKLKTFRALGWGNRN----GKLSIMLQTIYLLHLKRNECKRKL-------NFN 194
            |:   |......::.   ...|||..:    |....:.:.:.:..:....|:..|       :|.
  Fly   276 CL---PTTSFVGQRC---WVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFV 334

  Fly   195 LNSRQ-ICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPEC--RGV-GVYTDVT 254
            |:... ||||.:.| |.|.||.|.||    :..||..:.| :|:|::| ..|  .|| |||.:|.
  Fly   335 LSPTSFICAGGEAGKDACTGDGGSPL----VCTSNGVWYV-VGLVAWG-IGCAQAGVPGVYVNVG 393

  Fly   255 SYVDWISSTI 264
            :|:.||.:|:
  Fly   394 TYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/257 (28%)
Tryp_SPc 38..263 CDD:238113 74/259 (29%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 71/247 (29%)
Tryp_SPc 169..399 CDD:214473 69/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.