DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG14088

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:269 Identity:75/269 - (27%)
Similarity:123/269 - (45%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSI--WMAAIFNSSDFQCGGTIIH 69
            ||:|:.|.:.::.....:||...||...        |...|:.:  |.|.:.:.......||:||
  Fly     8 VAVLTSLLIFLSGTGSAQFLGNICGERR--------DGLSPDIVGPWTAILHHFGRIVGVGTLIH 64

  Fly    70 MRFVLSAAHC-----LVRGYDLYVRLG--ARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQL 127
            .||:|:..||     ::|     .|||  .|..:|.|..|.|...|.:.:|......|::||::|
  Fly    65 ERFILTDVHCGDSIGVIR-----ARLGEYGRIGSELAEDHIVAAFFSNANFNPETQANNMGLMKL 124

  Fly   128 SESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLKRNECKRKLN 192
            ..::||...:.|:||.:|..::...::|..|....|  :|...|.||::..::.:.: .|.:   
  Fly   125 LRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTW--KNSDKSPMLRSKTVIRMPQ-ACGK--- 183

  Fly   193 FNLNSRQICAGTKNGDTCRGDSGGPLSTNI--LFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTS 255
              |:..|.|||.|:.|:|...||..|:..|  :.|:.   .|..||.:..:.:|.....||||..
  Fly   184 --LDHGQFCAGHKDLDSCDEPSGAALTREIDYIGPNR---TVLFGIANSVEVKCSNSRTYTDVVQ 243

  Fly   256 YVDWISSTI 264
            ...|||..|
  Fly   244 LHQWISMVI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 63/233 (27%)
Tryp_SPc 38..263 CDD:238113 66/235 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 64/224 (29%)
Tryp_SPc 42..248 CDD:214473 61/221 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.