DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG18180

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:255 Identity:66/255 - (25%)
Similarity:119/255 - (46%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TPCGISTRPKISGGDD--------AAEPNSIWMAAIF-----NSSDFQCGGTIIHMRFVLSAAHC 79
            :|.|::....:|.|.:        |.|..:.::..:|     ::|.....||||...::|:||||
  Fly    18 SPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHC 82

  Fly    80 LVRGYDLYVRLGARNINEPAAVHTVI--NVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICI 142
            |...| :.:..|: |.....|....:  :.|:.|....|:...||||:: :..:.:...:..|.:
  Fly    83 LTGDY-VEIHYGS-NWGWNGAYRQTVRRDNFISHPDWPSQGGRDIGLIR-TPHVDFNGLINKIPL 144

  Fly   143 FLDPALKGSVEKLKT--FRALGWGNR-NGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGT 204
               |::....::.:.  ..|.|||.. ||.|:..||.:.:..:..:||::... ::.|..:|  |
  Fly   145 ---PSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYG-SVASTDMC--T 203

  Fly   205 KNGD---TCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECR-GVGVYTDVTSYVDWI 260
            ::.|   .|.|||||||.|:    .|...   :|:::|....|. |...||.|:.|::||
  Fly   204 RHADGKSVCGGDSGGPLVTH----DNARL---VGVITFASVSCHDGPSGYTRVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 62/244 (25%)
Tryp_SPc 38..263 CDD:238113 64/245 (26%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 60/236 (25%)
Tryp_SPc 36..259 CDD:238113 62/237 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.