DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG18179

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:248 Identity:69/248 - (27%)
Similarity:108/248 - (43%) Gaps:50/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KISGGDDAAEPNSIWMAAIF----NSSDFQCG-GTIIHMRFVLSAAHCLVR-----------GYD 85
            :|..|..|.|..:.::..:.    .|:....| ||||...::|:|||||..           |::
  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWN 103

  Fly    86 LYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKG 150
            ...|...|..|           |:.|....:|...||||:: :.|:.:|..:..:      ||..
  Fly   104 GAFRQSVRRDN-----------FISHPNWPAEGGRDIGLIR-TPSVGFTDLINKV------ALPS 150

  Fly   151 SVEKLKTF-----RALGWGNR-NGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKNG-D 208
            ..|:...|     .|.|||.. ||.|:..||.:.:..:..:||::... .:.|..:|....:| .
  Fly   151 FSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYG-TVASTDMCTRRTDGKS 214

  Fly   209 TCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECR-GVGVYTDVTSYVDWI 260
            :|.|||||||.|:    .|...   :|:::||..:|. |...||.||.|:.||
  Fly   215 SCGGDSGGPLVTH----DNARL---VGVITFGSVDCHSGPSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 67/246 (27%)
Tryp_SPc 38..263 CDD:238113 69/247 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 67/246 (27%)
Tryp_SPc 40..263 CDD:238113 69/247 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.