DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG3088

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:239 Identity:67/239 - (28%)
Similarity:106/239 - (44%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISGGDDAAE---PNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPA 99
            |:.|..|.|   |..:.||  |..|:..|.||||...::|::|.||.....:.:..||..:::..
  Fly    29 ITNGSPAYEGQAPYVVGMA--FGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQ 91

  Fly   100 AVHTVINVFVHHDFIASEY---RNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRA- 160
            ...||         ..|||   ...:.|:::.. :.::.||..:.:   |:|:...::.:.:.| 
  Fly    92 FTVTV---------GTSEYVTGNQHLALVRVPR-VGFSNRVNRVAL---PSLRNRSQRYENWWAN 143

  Fly   161 -LGWG---NRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQI-CAGTKNG-DTCRGDSGGPLS 219
             .|||   ..|| |:..||.:.|..:..|||.........|.|| |..|.:| .||.||:|.||.
  Fly   144 VCGWGVTTFSNG-LTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLI 207

  Fly   220 TNILFPSNKSYEVQLGIVSFGDPECRGVGV---YTDVTSYVDWI 260
            |       |.....:||.:|.......:|:   :..:||.:|||
  Fly   208 T-------KQDSTVVGISAFVASNGCTLGLPAGFARITSALDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 65/237 (27%)
Tryp_SPc 38..263 CDD:238113 67/239 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 67/239 (28%)
Tryp_SPc 29..244 CDD:214473 65/237 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.