DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and sphinx2

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:297 Identity:66/297 - (22%)
Similarity:108/297 - (36%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNS----SDF 61
            |:.:|::.:|| ||..|.|.....           |:|:||..|.....|::..|..:    |..
  Fly     1 MKLVVALLVLS-LTFSVCEKNKLS-----------PRITGGYRAKPYTIIYLVGIVYAKSPLSSL 53

  Fly    62 QCG-GTIIHMRFVLSAAHCLV--------------RGYDLYVRLGARNINEPAAVHTVINVFVHH 111
            :.| ||||..:::|:....|:              .|||:     .|...|        |.:.|:
  Fly    54 KFGAGTIISNQWILTVKEVLIFKYIEAHFGSKRAFWGYDI-----LRIYRE--------NFYFHY 105

  Fly   112 D------FIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKL--KTFRALGWG--NR 166
            |      .:...|       |..:..:..|||        ||.....|:.  ......|||  .|
  Fly   106 DKTRIIALVKCPY-------QKFDRRMSRVRV--------PAYGARFERYVGNMTMVCGWGTDKR 155

  Fly   167 NGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQIC-AGTKNGDTCRGDSGGPLSTNILFPSNKSY 230
            ..:|...::.:.:..:...|| .|.:..|...::| :|......|.||.||.:.|   ...|.::
  Fly   156 KVRLPTWMRCVEVEVMNNTEC-AKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVT---MGPNPTF 216

  Fly   231 EVQLGIV-------SFGDPECRGVGVYTDVTSYVDWI 260
               :||:       |.|.|     .|:..|:.::.||
  Fly   217 ---IGIIWLMPTNCSIGYP-----SVHIRVSDHIKWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 55/259 (21%)
Tryp_SPc 38..263 CDD:238113 57/260 (22%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 55/259 (21%)
Tryp_SPc 26..248 CDD:304450 57/260 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.