DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG10469

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:285 Identity:81/285 - (28%)
Similarity:127/285 - (44%) Gaps:58/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVSVALLSLL------TLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQ 62
            ||.:...||:      :|.:......|..:.|..:.......|..|  |||             .
  Fly     5 LVLIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKD--EPN-------------M 54

  Fly    63 CGGTIIHMRFVLSAAHCL----VRGYDLYVRLG-ARNINEPAAVHTVINVFVHHDFIASEYRNDI 122
            |||||:..|::::|||||    ...:.:.:.:| .::.::...|.......||..|......|||
  Fly    55 CGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDI 119

  Fly   123 GLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTF---RAL--GWGNRNGKL-SIMLQTIYLLH 181
            .|::|.:.:.:...:||..:   |:.|      ||:   :|:  |||....:| |.:||.|....
  Fly   120 ALIKLPKKLTFNKYIQPAKL---PSAK------KTYTGRKAIISGWGLTTKQLPSQVLQYIRAPI 175

  Fly   182 LKRNECKRKLNFNLNSRQ--------ICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVS 238
            :...||:|:.|..|..:.        ||..:|.|..||||||||:   :|...:::.   :||||
  Fly   176 ISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPM---VLDDGSRTL---VGIVS 234

  Fly   239 FG-DPEC--RGVGVYTDVTSYVDWI 260
            .| |.||  :...|.|.|:||:.||
  Fly   235 HGFDGECKLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/244 (30%)
Tryp_SPc 38..263 CDD:238113 74/245 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 74/265 (28%)
Tryp_SPc 24..260 CDD:238113 76/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.