DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:283 Identity:78/283 - (27%)
Similarity:116/283 - (40%) Gaps:60/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAI----FNSSDFQCG 64
            ::.|.|.|...|...........:.|.|.....:|:.|..|.|....::.|:    .|...:.||
  Fly     3 VLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWYCG 67

  Fly    65 GTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSE 129
            |:||...:||:||||......:.:..||....:|.        |.|:|  .....|||.|::...
  Fly    68 GSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQ--------FTHYD--TGNLHNDIALIRTPH 122

  Fly   130 ----SIVYTVRVQPICIFLDPALKGSVEKLKTFRAL--GWGNRNGKLSIMLQTIYL----LHLKR 184
                |:|..|.:        |...........:.||  |||:.:....:   |.||    :.:..
  Fly   123 VDFWSLVNKVEL--------PRYDDRYNNFYGWWALLSGWGSSSDSSGM---TDYLNCVDIQISD 176

  Fly   185 NE-CKRKLNF----NLNSRQICAGT-KNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPE 243
            |. |   |::    .:.|..:|..| :|..:|.|||||||   :|...|:    |:||||||...
  Fly   177 NSVC---LDYYGSHYITSNHLCYATPENKGSCSGDSGGPL---VLHDGNR----QVGIVSFGSAA 231

  Fly   244 -C-----RGVGVYTDVTSYVDWI 260
             |     :|:   |.||.|:|||
  Fly   232 GCLSNSPKGL---TRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 70/248 (28%)
Tryp_SPc 38..263 CDD:238113 72/249 (29%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 70/248 (28%)
Tryp_SPc 37..254 CDD:238113 72/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.