DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:256 Identity:68/256 - (26%)
Similarity:114/256 - (44%) Gaps:36/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ETPCGISTRPKISGGDDAAE---PNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYV 88
            :.|...:...:|:.|..|..   |..:.::....|..:.|||:||...:||:||||......:.:
  Fly    29 DLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTI 93

  Fly    89 RLGARNINEPAAVHTVI--NVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGS 151
            ..||........|.||.  |...|..:.:...||||.|:: :.::.:|..:..:.:   ||:.|:
  Fly    94 YYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVEL---PAIAGT 154

  Fly   152 VEKLKTFRAL--GWGNRNGKLSIMLQTI-YLLH--LKRNECKRKL-NFNLNSRQICAGTKNG-DT 209
            .......:|:  |||..:...:.:..|: |.:.  :..::|:... :....:..||..|.|. .|
  Fly   155 YSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVST 219

  Fly   210 CRGDSGGPLSTNILFPSNKSYEVQLGIVSF--------GDPECRGVGVYTDVTSYVDWISS 262
            |.|||||||   :|...:|    .:|:.||        |.|     ..:|.||||:|||.:
  Fly   220 CNGDSGGPL---VLVSDSK----LIGVTSFVSSAGCESGAP-----AGFTRVTSYLDWIKT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 65/242 (27%)
Tryp_SPc 38..263 CDD:238113 67/245 (27%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 65/242 (27%)
Tryp_SPc 40..269 CDD:238113 67/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.