DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and yip7

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:253 Identity:75/253 - (29%)
Similarity:116/253 - (45%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LETPCGISTRPKISGGDDAAE---PNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRGYDLY 87
            :.||   |...:|:.|.||..   |..:.::...::..:.|||:||...:||:||||......:.
  Fly    31 VSTP---SITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVT 92

  Fly    88 VRLGARNINEPAAVHTVIN--VFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKG 150
            :..||.....|.....|.:  ...|..::|...||||.|:|.| |:.::..|..|.:   ||:..
  Fly    93 IYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQTS-SVSFSATVNKISL---PAVSN 153

  Fly   151 SVEKL--KTFRALGWGNRNGKLSIM---LQTIYLLHLKRNECKRKL-NFNLNSRQICAGTKN-GD 208
            |....  ||..|.|||..:.:.:.:   ||.:.|..:..::|:... :..:.||.:|..|.| ..
  Fly   154 SYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKAS 218

  Fly   209 TCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDP---ECRGVGVYTDVTSYVDWISST 263
            ||:|||||||:.:         .|.:|..|||..   |......:|.:|.|.|||..|
  Fly   219 TCQGDSGGPLALD---------GVLIGATSFGSADGCESGAPAAFTRITYYRDWIKET 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 69/237 (29%)
Tryp_SPc 38..263 CDD:238113 71/239 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 69/237 (29%)
Tryp_SPc 40..267 CDD:238113 71/239 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.