DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG15873

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:91/225 - (40%) Gaps:45/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTVINVFVHHDF-------IASEY-- 118
            |.|.::..|.||:|||||...|.  ..:..|.|.......|.:.|:...||       :..||  
  Fly    69 CSGVLVSSRAVLTAAHCLTDRYK--ASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYER 131

  Fly   119 --RNDIGLLQLSESIVYTVRVQPICIFLDPAL---KGSVEKLKTFRALGWGN--RNGKLSIMLQT 176
              :||:.:|:|||      |||.....:.|.|   ..:|....|...||||.  ::|..|..|  
  Fly   132 YKKNDLAILRLSE------RVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNEL-- 188

  Fly   177 IYLLHLKR--NECKRKLNFNLNSRQICAGTKNGDT--CRGDSGGP-LSTNILFPSNKSYEVQLGI 236
            :||..:.|  :.|::..:.......:|. ...|::  |.||.||| |....||          |:
  Fly   189 VYLDVILRPPSLCQKHYDTFTADHNVCT-EPVGESMNCAGDMGGPLLCKGALF----------GL 242

  Fly   237 VSFGDPECRG--VGVYTDVTSYVDWISSTI 264
            :. |...|.|  ...:.....|.|||..||
  Fly   243 IG-GHMGCAGGKAMKFLSFLYYKDWILLTI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 60/219 (27%)
Tryp_SPc 38..263 CDD:238113 62/222 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 56/202 (28%)
Tryp_SPc 59..250 CDD:238113 56/202 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.