DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30414

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:306 Identity:95/306 - (31%)
Similarity:143/306 - (46%) Gaps:54/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLVSVALLSLLTLCVTENEHFKFLETPCGISTRPK----ISGGDDAAEPNSIWMAAIFNSSDF 61
            |:.:.:...|.:.::.:.|......|::.|| :|:|:    |:||.||...::.||..:....  
  Fly     1 MKFIAAGLALLVCSIQLGEGAPGHLLDSSCG-TTKPEFIPMITGGADAGLFSNPWMVKVLGEK-- 62

  Fly    62 QCGGTIIHMRFVLSAAHCLV-------------------------RGYDL-YVRLGARNINEP-- 98
            .|||::|..||||:||||:|                         :.|.| .:|||..:...|  
  Fly    63 LCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGK 127

  Fly    99 -AAVHTVINVFVHHDFIASEYR----NDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTF 158
             ..|.....:.|....:.::|.    ||||||::...:.|:..|:|||:.::    |.:.:...|
  Fly   128 DCCVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVE----GHMAESPIF 188

  Fly   159 RALGWGNRN-GKLSIMLQ--TIYL--LHLKRNECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPL 218
            ...|||..| |..|..||  |:|.  ||.    |:.|....::..||||...|.|.|.|||||||
  Fly   189 NITGWGVTNDGTPSRRLQRATVYNTDLHF----CRSKFTKQVDESQICAAGTNSDACHGDSGGPL 249

  Fly   219 STNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTSYVDWISSTI 264
            |..:.| :......|.|:||:|...|....|||:||.:.|||.:.|
  Fly   250 SAQVPF-AGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 84/264 (32%)
Tryp_SPc 38..263 CDD:238113 86/262 (33%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 84/259 (32%)
Tryp_SPc 41..290 CDD:238113 84/259 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.