DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG13527

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:297 Identity:69/297 - (23%)
Similarity:119/297 - (40%) Gaps:78/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAE------------PNSIWMAAIFNSS 59
            ||:|..:.:.::.....|.|.:       ||.. ||:..|            ||.      :...
  Fly     8 VAILITVMVILSGAHRMKRLSS-------PKFH-GDETLELAKYVVSIRSRTPNK------YFGD 58

  Fly    60 DFQCGGTIIHMRFVLSAAHCLV-------RGYDLYVRLGA---------RNINEP-AAVHTVINV 107
            :..|||.::..::|::||||::       :...|.|..|:         :::..| ::::...|.
  Fly    59 NHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNF 123

  Fly   108 FVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLK-TFRALGWGNR--NGK 169
            .:|:.|       ::.|::|.|.:...   .|...||.  |.....|:. ....||||..  .|.
  Fly   124 TMHNTF-------NMALMKLQEKMPSN---DPRIGFLH--LPKEAPKIGIRHTVLGWGRMYFGGP 176

  Fly   170 LSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKN----GDTCRGDSGGPLSTNILFPSNKSY 230
            |::.:..:.::.:....||.... :.....:|||..|    .:.|.||.|.||         .|.
  Fly   177 LAVHIYQVDVVLMDNAVCKTYFR-HYGDGMMCAGNNNWTIDAEPCSGDIGSPL---------LSG 231

  Fly   231 EVQLGIVSFGDP---ECRGV-GVYTDVTSYVDWISST 263
            :|.:|||::  |   .|..: .|||||.|.:.||..|
  Fly   232 KVVVGIVAY--PIGCGCTNIPSVYTDVFSGLRWIRHT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 60/262 (23%)
Tryp_SPc 38..263 CDD:238113 61/264 (23%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 58/252 (23%)
Tryp_SPc 43..263 CDD:214473 56/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.