DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30283

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:272 Identity:105/272 - (38%)
Similarity:153/272 - (56%) Gaps:12/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VSVALLSLLTLCVTENEHFKFLETPCGISTRP----KISGGDDAAEPNSIWMAAIFNSSDFQCGG 65
            |.|.||:..::.|..:|...|||.|||  |.|    ||.||.:|...::.|||.:.....|.|||
  Fly     8 VVVVLLAASSVVVLGSESGSFLEHPCG--TVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGG 70

  Fly    66 TIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSES 130
            |:|..||||::|||:..| :|.||||.......|....|..:|||.|:...::  |:.||:|::.
  Fly    71 TLITNRFVLTSAHCIANG-ELKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQH--DLALLRLAKR 132

  Fly   131 IVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKLSI-MLQTIYLLHLKRNEC-KRKLNF 193
            :.|:..:.|||:.|||.:|...|.:..||..|||....:.|. |||...|.:|.|:|| |:..:.
  Fly   133 VHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQ 197

  Fly   194 NLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTSYVD 258
            .:|...|||.:.|.:||.||||||| |.|:...:.....|.|:.|||..:|....|:|:|.:::|
  Fly   198 QINRNHICAESANANTCNGDSGGPL-TAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLD 261

  Fly   259 WISSTIARNDYL 270
            ||.:|:.|.:.:
  Fly   262 WIVNTVRRAEIM 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 87/224 (39%)
Tryp_SPc 38..263 CDD:238113 88/226 (39%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 87/224 (39%)
Tryp_SPc 43..266 CDD:238113 88/226 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I7012
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
66.050

Return to query results.
Submit another query.