DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and try-9

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:270 Identity:54/270 - (20%)
Similarity:105/270 - (38%) Gaps:84/270 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FNSSDF-QCG-GTIIHMRFVLSAAHCL--------------------VRGYDLYVR--------- 89
            |:.::| |.| ||::....:::|||.:                    ||.|..:|.         
 Worm    19 FSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVP 83

  Fly    90 -----LGARNINEPAAVHT--VINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPA 147
                 |..:::.:|.|:.:  :...:|....|..|..|||.:.:|.|.|.::..:.|.|:...| 
 Worm    84 EMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSAP- 147

  Fly   148 LKGSVEKLKT--FRALGWGN-------RNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAG 203
               .:.:::.  ::..|:|.       .:|||..:...:       .||..  :|........:.
 Worm   148 ---KIPRIRETGYKLFGYGRDPSDSVLESGKLKSLYSFV-------AECSD--DFPYGGVYCTSA 200

  Fly   204 TKNGDTCRGDSG-GPLSTNILFPSNKSYEVQLGIVSFGDPEC------------------RGVGV 249
            ...|.:|.|||| |.:.|:    ..::.:|.:|::|.|.| |                  :...:
 Worm   201 VNRGLSCDGDSGSGVVRTS----DTRNVQVLVGVLSAGMP-CPELYDTHNRQRQQRRQLTQETDL 260

  Fly   250 YTDVTSYVDW 259
            ..||:::||:
 Worm   261 LVDVSAHVDF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 54/270 (20%)
Tryp_SPc 38..263 CDD:238113 54/270 (20%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 45/224 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.