DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG4650

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:267 Identity:78/267 - (29%)
Similarity:124/267 - (46%) Gaps:28/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSS-DFQCGGTIIHMR 71
            |||.||.:..:.    ::|:..||:.|..||     |...:|.|||.:..|. .:.||||:|..:
  Fly    10 ALLFLLPVPGSS----QYLDGRCGLLTNGKI-----ANNISSPWMAYLHTSELLYVCGGTVITEK 65

  Fly    72 FVLSAAHCLVRGYDLYVR----LGARNINEP-AAVHTVINVFVHHDFIASEYRNDIGLLQLSESI 131
            .||:||||......|..|    :|..:.|:. .:.:.|...|:|..:..:...|||.:|.|:..|
  Fly    66 LVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDI 130

  Fly   132 VYTVRVQPICIFLDPALKGSVEKLKTFRALGWG---NRNGKLSIMLQTIYLLHLKR---NECKRK 190
            |::..::||||......:..::.::......||   :||..     ....:..::|   |.|...
  Fly   131 VFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNES-----DAFRITDIRRQPANMCSTL 190

  Fly   191 LNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTS 255
            ....:.|.|.|||..:...|..|...||...|.|.:.:.| |.:||.: .:.:|:...|||||.|
  Fly   191 NGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRY-VLIGIAT-TNQKCKRASVYTDVLS 253

  Fly   256 YVDWISS 262
            :.|:|.|
  Fly   254 HTDFILS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 67/234 (29%)
Tryp_SPc 38..263 CDD:238113 68/237 (29%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/236 (28%)
Tryp_SPc 33..258 CDD:304450 67/236 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.