DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG9377

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:292 Identity:68/292 - (23%)
Similarity:115/292 - (39%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TENEHFKFLETPCGISTR---PKI--------SGG---------------DDAAEPNSIWMAAIF 56
            |.:|:..::|..|.|..:   |||        .||               .:|......|:.|::
  Fly    55 TLDENCHYMEKCCNIPDKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVY 119

  Fly    57 NSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNIN-------EPAAVHTVINVFVHHDFI 114
            .|..:.|.|.:|....|::.|||:.......|||.|...:       :|....:|:...||.::.
  Fly   120 GSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYT 184

  Fly   115 ASEYRNDIGLLQLSESIVYTV--RVQPICIFLDPALKGSVEKLKTFRALGWGNRN-GKLSIMLQT 176
            .....::|.:|.:.:...:.:  .|||||: ..|.:..:..:.   ...||...: |:.:|:.:.
  Fly   185 QMPLAHNIAILLVDKEKPFQLAPNVQPICL-PPPRIMYNYSQC---YVSGWQRSDFGRAAILPKR 245

  Fly   177 IYLLHLKRNECKRKLNFNL-------NSRQICAGTKNGDTCRGD---SGGPLSTNILFPSNKSYE 231
            ..|..|..::|:.||..:|       |...:|||...||...||   :..||...:   |.....
  Fly   246 WTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPL---SGHDDR 307

  Fly   232 VQLGIVSFGDPECRG---VGVYTDVTSYVDWI 260
            ..|..:......|.|   :|:||:|..|..||
  Fly   308 FHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 60/268 (22%)
Tryp_SPc 38..263 CDD:238113 61/269 (23%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/242 (24%)
Tryp_SPc 105..339 CDD:214473 56/240 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.