DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and Hayan

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:283 Identity:95/283 - (33%)
Similarity:135/283 - (47%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RPKI-------SGG-------------DDAAEPNSIWMAAI----FNSSDFQCGGTIIHMRFVLS 75
            ||.:       |||             |....|:   ||||    |.|:.|:|||::|..||||:
  Fly   365 RPSVAACEKIRSGGKPLTVHILDGERVDRGVYPH---MAAIAYNSFGSAAFRCGGSLIASRFVLT 426

  Fly    76 AAHCLVRGYD---LYVRLGARNINEPAAVH---TVINVFVHHDFIASEYRNDIGLLQLSESIVYT 134
            |||| |...|   .:|||||.||..|...:   .||:|.:|.|:..|....||.:|||:|....:
  Fly   427 AAHC-VNSDDSTPSFVRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKES 490

  Fly   135 VRVQPICIFLD----PALKGSVEKLKTFRALGWG---NRNGKLSIMLQTIYLLHLKRNEC----- 187
            ..::|.|::.|    ||      ..|.|.| |||   ..|..:|.:|....|..:..:||     
  Fly   491 DVIRPACLYTDRSDPPA------NYKYFVA-GWGVMNVTNRAVSKILLRAALDLVPADECNASFA 548

  Fly   188 -----KRKLNFNLNSRQICAGTKN--GDTCRGDSGGPLSTNILFPSNKSYEVQLGIVS--FGDPE 243
                 .|.|...:.:.|:||..||  .|.|:|||||||...| ...:.:|.: :|::|  ||   
  Fly   549 EQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEI-DDVDGTYSI-VGVISSGFG--- 608

  Fly   244 C--RGVGVYTDVTSYVDWISSTI 264
            |  :..|:||.|:|::|:|...:
  Fly   609 CATKTPGLYTRVSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 92/275 (33%)
Tryp_SPc 38..263 CDD:238113 93/277 (34%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 89/258 (34%)
Tryp_SPc 385..630 CDD:238113 90/260 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.