DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and sphe

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:245 Identity:66/245 - (26%)
Similarity:103/245 - (42%) Gaps:36/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHC------LVRGYDLYVRLGARNI 95
            :|.||:||....:.:.|::...:...|||:|:....:|:.|||      |:....|..|:|:.|.
  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQ 89

  Fly    96 NEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKL----K 156
            .....:..|.:|.||.|:.  ...|::.::.||..:.||.|:..|      .|..|.|.|    .
  Fly    90 YAGGKIVNVESVAVHPDYY--NLNNNLAVITLSSELTYTDRITAI------PLVASGEALPAEGS 146

  Fly   157 TFRALGWG-NRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAG--TKNGDTCRGD-SGGP 217
            .....||| ..:|..|..::.|.|.......|....: :.:.:..|..  .|.| ||.|| .||.
  Fly   147 EVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYS-DHDEQSFCLAHELKEG-TCHGDGGGGA 209

  Fly   218 LSTNILFPSNKSYEVQLGIVSFGDPEC--RGVGVYTDVTSYVDWISSTIA 265
            :..|.|          :|:.:|....|  |...|:..::||.|||...||
  Fly   210 IYGNTL----------IGLTNFVVGACGSRYPDVFVRLSSYADWIQEQIA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 62/238 (26%)
Tryp_SPc 38..263 CDD:238113 64/240 (27%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/224 (26%)
Tryp_SPc 42..244 CDD:214473 56/221 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.