DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG31220

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:279 Identity:90/279 - (32%)
Similarity:129/279 - (46%) Gaps:64/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CG-ISTRPKISGGDDAAEPN---SIWMAAIF--NSSDF--------QCGGTIIHMRFVLSAAHCL 80
            || ..|..::.||   .|||   ..|:|.:.  |.|.|        .|||::|:.|:||:||||:
  Fly    95 CGKPQTTNRVIGG---TEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCV 156

  Fly    81 VRGYDLYVRL-------------------GARNINEPAAVH-TVINVFVHHDFIASEY--RNDIG 123
            .   |..:::                   |||.:..|..:. .|.::..|:|:..:.|  ||||.
  Fly   157 T---DTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIA 218

  Fly   124 LLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKL---SIMLQTIYLLHLKRN 185
            |::|.|.:.||:...|||:...|.   |:.|.|.:.| ||| :.|..   |.:|:...:...|..
  Fly   219 LVRLKEPVRYTMAYYPICVLDYPR---SLMKFKMYVA-GWG-KTGMFDTGSKVLKHAAVKVRKPE 278

  Fly   186 ECKRK-LNFNLNSR-QICA-GTKNGDTCRGDSGGPLSTNILFPSNKSYEV---QLGIVSFGDPEC 244
            ||..| .:.:...| |||| |..|..||.||||.||    :..|.:|||.   ..||.|:|.| |
  Fly   279 ECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPL----MGTSGRSYETITFLAGITSYGGP-C 338

  Fly   245 RGVG---VYTDVTSYVDWI 260
            ..:|   |:|....:..||
  Fly   339 GTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 85/269 (32%)
Tryp_SPc 38..263 CDD:238113 87/270 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 85/269 (32%)
Tryp_SPc 104..360 CDD:238113 87/270 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.