DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG8952

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:123/277 - (44%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSS--DFQCGGTII 68
            |:.|:.|..:.|..........:|..|..|  |..|.||......|...:...:  |..|||:||
  Fly     8 SLMLVLLAAISVVGQPFDPANSSPIKIDNR--IVSGSDAKLGQFPWQVILKRDAWDDLLCGGSII 70

  Fly    69 HMRFVLSAAHCLVRGYDLYVRLGARNI-NEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIV 132
            ...:||:||||......:::..|..:: |..|...|..|:.:|.|: ..:..||:.|:||.|.:.
  Fly    71 SDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNNIIIHPDY-NDKLNNDVSLIQLPEPLT 134

  Fly   133 YTVRVQPICIF------LDPALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLK---RNECK 188
            ::..:|.|.:.      :|  ..|||..:     .|:|....:.....:|:....::   ..:|.
  Fly   135 FSANIQAIQLVGQYGDSID--YVGSVATI-----AGFGYTEDEYLDYSETLLYAQVEIIDNADCV 192

  Fly   189 RKL-NFNLNSRQICAGTKNG---DTCRGDSGGPLSTNILFPSNKSYE--VQLGIVSF-GDPEC-- 244
            ... .:.:....:||...:|   .||.|||||||   ||:  ||:.:  .|:||.|| .:.:|  
  Fly   193 AIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL---ILY--NKTIQQWQQIGINSFVAEDQCTY 252

  Fly   245 RGVGVYTDVTSYVDWIS 261
            |....|..|:|::.:|:
  Fly   253 RLPSGYARVSSFLGFIA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 66/243 (27%)
Tryp_SPc 38..263 CDD:238113 67/245 (27%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 67/245 (27%)
Tryp_SPc 38..271 CDD:238113 67/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.