DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and spirit

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:270 Identity:88/270 - (32%)
Similarity:126/270 - (46%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDF------QCGGTIIHMRFVLS 75
            |.|.:.| |:....|:.|||:          ...:|||:...|:|      :|||.:|...|||:
  Fly   122 VKEIDEF-FVSVVGGMPTRPR----------EFPFMAALGWRSNFDQRIYYRCGGALIANNFVLT 175

  Fly    76 AAHCLVRGYD--LYVRLGARNI----NEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYT 134
            ||||...|.:  ..||||..|:    .|..::..||   :|.|:.||...|||.||:|..:.  .
  Fly   176 AAHCADLGGEPPSQVRLGGDNLTLTEGEDISIRRVI---IHPDYSASTAYNDIALLELETAA--K 235

  Fly   135 VRVQPICIFLDPALKGSVEKLKTFRALGWGNRN--GKLSIMLQTIYLLHLKRNEC-----KRKLN 192
            ..::|.||:....:..::     ..|:|:|..:  |..|..|..:.|..:...||     |.:|.
  Fly   236 PELKPTCIWTQKEVTNTL-----VTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLA 295

  Fly   193 FNLNSRQICAGTKNG--DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRG-VGVYTDVT 254
            ..:...|:|||...|  |||:|||||||   ::......|.|  ||.|.|.....| ..|||.|:
  Fly   296 QGVLGTQMCAGDITGERDTCQGDSGGPL---LMQDGLLGYVV--GITSLGQGCASGPPSVYTRVS 355

  Fly   255 SYVDWISSTI 264
            |:||||...:
  Fly   356 SFVDWIEGIV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 78/244 (32%)
Tryp_SPc 38..263 CDD:238113 80/246 (33%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 84/256 (33%)
Tryp_SPc 132..361 CDD:214473 82/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.