DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG18420

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:271 Identity:89/271 - (32%)
Similarity:136/271 - (50%) Gaps:23/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVSVALLSLLTLCVTENEHF------KFLETPCG----ISTRPKISGGDDAAEPNSIWMAAIFNS 58
            :|.:.:.|:|.|...    |      :||::.||    :...|:|..|..|...:|.|||.:..|
  Fly     3 IVVIGMASILLLLTV----FPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTS 63

  Fly    59 SD-FQCGGTIIHMRFVLSAAHCLVRGYDLYVRLGA--RNINEPAAVHTVINVFVHHDFIASEYRN 120
            |: |.||||:|..|.||:||||.:....:.||||.  |.:......|.|...|.|..:..:.:.|
  Fly    64 SNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTHAN 128

  Fly   121 DIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKL-SIMLQTIYLLHLKR 184
            ||.||:|..::||...::||||..|.:.|..::.:|.....|||...... |..|:|   |.:.|
  Fly   129 DIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRT---LDISR 190

  Fly   185 NECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGV 249
            ...|.....::.|.|.|||..|.:.|.||:|||:...:.: .|....||:|| :..:..|:...|
  Fly   191 QPSKMCAFGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRY-RNAFRFVQVGI-AITNKRCQRPSV 253

  Fly   250 YTDVTSYVDWI 260
            :|||.|::::|
  Fly   254 FTDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 78/226 (35%)
Tryp_SPc 38..263 CDD:238113 79/227 (35%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 78/226 (35%)
Tryp_SPc 43..267 CDD:238113 79/227 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463428
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.