DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG33459

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:258 Identity:90/258 - (34%)
Similarity:135/258 - (52%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LETPCG-ISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLV-RGYDLYV 88
            ||..|| |..|.:|.||.||...::.|||.:.|...|.|||::|...|||:||||:: ...:|.|
  Fly    25 LEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNLTV 89

  Fly    89 RLG----ARNINEPAAVH-----TVINVFVHHDFIASEYRN----DIGLLQLSESIVYTVRVQPI 140
            |||    .|.::.....|     .|..::.|     ..||:    ||.||:|::::.|||.::||
  Fly    90 RLGEYDWTRQMDSINPKHRHREYMVTRIYTH-----PSYRSIAAYDIALLKLNQTVEYTVAIRPI 149

  Fly   141 CIFLDPALK---GSVEKLKTFRALGWG-NRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQIC 201
            |:.|.....   ..|:.::.|...||| .:...:|.:||:..|..:.|..|..:...:::...||
  Fly   150 CLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGHSVDHTHIC 214

  Fly   202 AGTKNGDTCRGDSGGPLSTNILFPSNKSY-EVQLGIVSFGDPECRGVGVYTDVTSYVDWISST 263
            ||:.....|.||||.||:..::  .|:.| ..|:||||.|...|.||.|:|:|.|:.:||..|
  Fly   215 AGSSKSFACVGDSGSPLAMKVV--HNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEWIFRT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 81/241 (34%)
Tryp_SPc 38..263 CDD:238113 83/243 (34%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 81/241 (34%)
Tryp_SPc 38..272 CDD:238113 81/240 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.