DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG33458

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:275 Identity:92/275 - (33%)
Similarity:144/275 - (52%) Gaps:17/275 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALLSLLTLCVTENEHFKF-LETPCGISTRP-KISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHM 70
            |||:||.|....:..:.: ||..||||... :|:||.|:....:.|:|.:..:|.|.|||::::.
  Fly     6 ALLALLILGHGISLGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNH 70

  Fly    71 RFVLSAAHCL-VRGYDLYVRLGAR--------NINEPAAVH---TVINVFVHHDFIASEYRNDIG 123
            .|||:||||. .:...:.||||..        |.:|.||.|   .::...:|..:..:.| .||.
  Fly    71 WFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHY-YDIA 134

  Fly   124 LLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN-GKLSIMLQTIYLLHLKRNEC 187
            |.:|:..:|||..::|||:.|:|..:..|:.::.|...|||..| .::|..||...:..:.|..|
  Fly   135 LAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTC 199

  Fly   188 KRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTD 252
            :....:.::...||||.......:|||||||.:.:.:...|.: .|.||||.......||.|:|:
  Fly   200 RYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRF-FQFGIVSHLRQPFHGVSVFTN 263

  Fly   253 VTSYVDWISSTIARN 267
            :.||.:||..||..|
  Fly   264 ILSYSNWIHRTIITN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 75/235 (32%)
Tryp_SPc 38..263 CDD:238113 77/237 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 75/235 (32%)
Tryp_SPc 38..274 CDD:238113 77/237 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.