DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG33462

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:261 Identity:81/261 - (31%)
Similarity:115/261 - (44%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LETPCGI-------STRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRG 83
            ||..|||       |...|:     |..|   |||.:.....|.|.||:|:..|||:||||:...
  Fly    25 LEEDCGIPHNISERSVNAKL-----AQNP---WMAYLETPKGFHCSGTLINHLFVLTAAHCVPDD 81

  Fly    84 YDLYVRLGARN-----------INEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRV 137
            ..:.||||..|           ..||...:.|...|.|..:.|::..||||:|:|...:.|...:
  Fly    82 LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHI 146

  Fly   138 QPICIFLDPALKGSVEKLKTFRALGW----GNRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSR 198
            :|||||.....:..:::|..|....|    .|...|   :|:|:.:....:..|.....:|:...
  Fly   147 RPICIFASNRFQEPIDQLTWFTTTVWRETAANATSK---VLRTMNIDRQPKETCSEIYGWNMTFE 208

  Fly   199 QICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTSYVDWISST 263
            |||||......|..|||.|....:....:..| |||||.|....:|:..|:..|:.||.|||...
  Fly   209 QICAGNTLSQLCSTDSGAPQIRKMWHNGSDRY-VQLGIASRVKGQCQNSGILMDLLSYADWIKRV 272

  Fly   264 I 264
            :
  Fly   273 V 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 73/237 (31%)
Tryp_SPc 38..263 CDD:238113 74/239 (31%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 73/230 (32%)
Tryp_SPc 48..269 CDD:214473 71/227 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463365
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.