DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG33461

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:275 Identity:98/275 - (35%)
Similarity:137/275 - (49%) Gaps:19/275 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VALLSLLTLCVTENEHFKFLETPCGISTR--PKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIH 69
            :|.|:|..|.| ......|||..||:..|  .||..|..|......|||.:...:.|.|.|::|:
  Fly    10 IAYLALFVLGV-HGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLIN 73

  Fly    70 MRFVLSAAHCLVRGYDLYVRLGARNIN-----------EPAAVHTVINVFVHHDFIASEYRNDIG 123
            ..|||::|||:....:|..|||..|.:           |....:.|..:|.|..:...::.||||
  Fly    74 QWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIG 138

  Fly   124 LLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWG----NRNGKLSIMLQTIYLLHLKR 184
            :|:|...:.||..:||||||....::..|:::..|:|.|||    :.|.|.|.:|..:.|....|
  Fly   139 MLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPR 203

  Fly   185 NECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGV 249
            |:|.|....|..|.|||||..:|:.||||||||....:|....|.: ||:||.||....|..|.:
  Fly   204 NDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRF-VQMGIASFTYENCSKVSI 267

  Fly   250 YTDVTSYVDWISSTI 264
            .|||..|..||...:
  Fly   268 LTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 85/237 (36%)
Tryp_SPc 38..263 CDD:238113 86/239 (36%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 85/237 (36%)
Tryp_SPc 42..281 CDD:238113 86/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463372
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.840

Return to query results.
Submit another query.