DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30323

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:315 Identity:60/315 - (19%)
Similarity:102/315 - (32%) Gaps:100/315 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLSLLT---------------LCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNS 58
            ||.|||               |.||:|.|    :....|.||..|....|               
  Fly     5 LLLLLTSSAYSNEGKKGLQRNLYVTDNYH----QNVVSIRTRKHIRHWGD--------------- 50

  Fly    59 SDFQCGGTIIHMRFVLSAAHCLV------------RGYDLYVRLGARNINEPAA--VHTVINVFV 109
             :..|.|:::...:|:::..|:.            |.....|....:.:.:|:.  ::.|..:.:
  Fly    51 -NHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVL 114

  Fly   110 HHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGN--------- 165
            ....|:.  ..::.||:|...    |..|...:.|.   :..:.......:||||.         
  Fly   115 DESAISG--CTELALLKLDRG----VTGQRFAMMLP---EKELNSTWLCNSLGWGRIYYVSYVYI 170

  Fly   166 ------------------RNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQIC--AGTKNGDTC 210
                              ::|..|..|..|....:...|||...     ||.:|  :.|..|:.|
  Fly   171 SAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDC-----SRCLCMTSYTGRGNMC 230

  Fly   211 RGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTSYVDWISSTIA 265
            :.|.|.|     ||..:..|.|...:.:..|   .|...||::.....:|..|::
  Fly   231 QQDLGSP-----LFCDHFLYGVARRVHTCDD---EGFMFYTNIYQNRKFIEDTLS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 45/265 (17%)
Tryp_SPc 38..263 CDD:238113 46/267 (17%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 46/267 (17%)
Tryp_SPc 45..272 CDD:214473 45/264 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.