DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30289

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:290 Identity:94/290 - (32%)
Similarity:149/290 - (51%) Gaps:30/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVSVALLSLLTLCVTENEHF-KFLETPCGISTR----PKISGGDDAAEPNSIWMAAIFNSSDFQC 63
            :::..:.:|:.|.:..|... :.|...||||..    |.|.||.......:.||..:::|.  .|
  Fly     3 VINAVIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSK--PC 65

  Fly    64 GGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAV----HTV-----INV---FVHHDFIAS 116
            ||::|..:|||:|||| |...|||||||.....:|...    |.:     |:|   .||.::...
  Fly    66 GGSLIARQFVLTAAHC-VSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGI 129

  Fly   117 EYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRN-GKLSIMLQTIYLL 180
            ..:|||.||::||::.|:..|:|||:.:..    .::.:..|...|||... |:.|.:|....|.
  Fly   130 TLQNDIALLRMSEAVEYSDYVRPICLLVGE----QMQSIPMFTVTGWGETEYGQFSRILLNATLY 190

  Fly   181 HLKRNECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECR 245
            ::..:.|..|.|...:..|||||:...:||:||||||||:...: .|:....|.|:||:|...|.
  Fly   191 NMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHY-GNRLLSFQYGLVSYGSERCA 254

  Fly   246 G--VGVYTDVTSYVDWISSTIARNDYLPIG 273
            .  .||||:|:.:.:||.:.:.:  :.|.|
  Fly   255 ANVAGVYTNVSYHREWIFNKMVQ--FKPTG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 81/237 (34%)
Tryp_SPc 38..263 CDD:238113 83/239 (35%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 81/236 (34%)
Tryp_SPc 42..271 CDD:238113 81/236 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
54.810

Return to query results.
Submit another query.