DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30288

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:276 Identity:98/276 - (35%)
Similarity:139/276 - (50%) Gaps:18/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLVSVALLSLLTLCVTENEHFKFLETPCGIST----RPKISGGDDAAEPNSIWMAAIFNSSDF 61
            :|.||.||   .|.:.:...|..:.||..||.::    |.:|.||.||...::.||..:..|...
  Fly     5 IRQLVIVA---CLFIGIIRTESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKA 66

  Fly    62 QCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEP-------AAVHTVINVFVHHDFIASEYR 119
            .|||::|..||||:|.||:...| :.||||..:...|       .......||.|....:.|...
  Fly    67 VCGGSLITARFVLTAEHCISPMY-MNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPG 130

  Fly   120 NDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWG-NRNGKLSIMLQTIYLLHLK 183
            .|||||::..|::::..|:|||:.|...|.|:...:..|...||| |.:|:....|||..|..|.
  Fly   131 YDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLP 195

  Fly   184 RNECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVG 248
            :..|:|. ...|:...||||:...|:|:||||||||....| ..:....|.|:.|.|...|.|:|
  Fly   196 QWSCERP-GRPLDISYICAGSYISDSCKGDSGGPLSAIRTF-EGQGRVFQFGVASQGLRLCSGLG 258

  Fly   249 VYTDVTSYVDWISSTI 264
            :||:||.:.|||...|
  Fly   259 IYTNVTHFTDWILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 83/230 (36%)
Tryp_SPc 38..263 CDD:238113 85/232 (37%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 83/230 (36%)
Tryp_SPc 45..270 CDD:238113 82/227 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.