DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30286

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:275 Identity:86/275 - (31%)
Similarity:140/275 - (50%) Gaps:28/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLTLCVTENEH--FKFLETPCGISTRPKISGGDDAAE-PNSIWMAAIFNSSDFQCGGTIIHMRFV 73
            |||..:..:.|  .:|||..||..:...:...:..|. ..|.|||.:..|.:..||||:::.||:
  Fly     6 LLTSLLPWHPHATAQFLEPDCGYMSPEALQNEEHQAHISESPWMAYLHKSGELVCGGTLVNHRFI 70

  Fly    74 LSAAHCLVRGYDLYVRLGARN-----------INEPAAVHTVINVFVHHDFIASEYRNDIGLLQL 127
            |:||||:....:|.||||..|           ...|:....:...|.|..:..:...:|||||:|
  Fly    71 LTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRL 135

  Fly   128 SESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGK-LSIMLQTIYLLHLKRNECKRKL 191
            ::|:.|.|.::|||:..:..|:..:|:|....|.|||....: .:.:|::|.:..:....|.:..
  Fly   136 AKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTY 200

  Fly   192 NFNLNSRQICAGTKNGDTCRGDSGGP------LSTNILFPSNKSYEVQLGIVSFGDPECRGVGVY 250
            ..:....|||...::|.:|.||||||      |...:||       ||:||||:|:.||....|:
  Fly   201 WVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLF-------VQVGIVSYGNAECLSPSVF 258

  Fly   251 TDVTSYVDWISSTIA 265
            |:|..::|||.:.::
  Fly   259 TNVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 75/241 (31%)
Tryp_SPc 38..263 CDD:238113 77/243 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 76/236 (32%)
Tryp_SPc 39..268 CDD:214473 75/235 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463414
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.